splitsource

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Split sequence(s) into original source sequences

Description

**************** EDIT HERE ****************

Algorithm

**************** EDIT HERE ****************

Usage

Here is a sample session with splitsource

Split a sequence into original subsequences


% splitsource qasrswww:A01139 
Split sequence(s) into original source sequences
output sequence(s) [a01139.fasta]: 

Go to the input files for this example
Go to the output files for this example

Command line arguments

Split sequence(s) into original source sequences
Version: EMBOSS:6.3.0

   Standard (Mandatory) qualifiers:
  [-sequence]          seqall     Sequence(s) filename and optional format, or
                                  reference (input USA)
  [-outseq]            seqoutall  [.] Sequence set(s)
                                  filename and optional format (output USA)

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -feature            boolean    [N] Retain feature information

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outseq" associated qualifiers
   -osformat2          string     Output seq format
   -osextension2       string     File name extension
   -osname2            string     Base file name
   -osdirectory2       string     Output directory
   -osdbname2          string     Database name to add
   -ossingle2          boolean    Separate file for each entry
   -oufo2              string     UFO features
   -offormat2          string     Features format
   -ofname2            string     Features file name
   -ofdirectory2       string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options and exit. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages
   -version            boolean    Report version number and exit

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequence]
(Parameter 1)
seqall Sequence(s) filename and optional format, or reference (input USA) Readable sequence(s) Required
[-outseq]
(Parameter 2)
seqoutall Sequence set(s) filename and optional format (output USA) Writeable sequence(s) <*>.format
Additional (Optional) qualifiers
(none)
Advanced (Unprompted) qualifiers
-feature boolean Retain feature information Boolean value Yes/No No
Associated qualifiers
"-sequence" associated seqall qualifiers
-sbegin1
-sbegin_sequence
integer Start of each sequence to be used Any integer value 0
-send1
-send_sequence
integer End of each sequence to be used Any integer value 0
-sreverse1
-sreverse_sequence
boolean Reverse (if DNA) Boolean value Yes/No N
-sask1
-sask_sequence
boolean Ask for begin/end/reverse Boolean value Yes/No N
-snucleotide1
-snucleotide_sequence
boolean Sequence is nucleotide Boolean value Yes/No N
-sprotein1
-sprotein_sequence
boolean Sequence is protein Boolean value Yes/No N
-slower1
-slower_sequence
boolean Make lower case Boolean value Yes/No N
-supper1
-supper_sequence
boolean Make upper case Boolean value Yes/No N
-sformat1
-sformat_sequence
string Input sequence format Any string  
-sdbname1
-sdbname_sequence
string Database name Any string  
-sid1
-sid_sequence
string Entryname Any string  
-ufo1
-ufo_sequence
string UFO features Any string  
-fformat1
-fformat_sequence
string Features format Any string  
-fopenfile1
-fopenfile_sequence
string Features file name Any string  
"-outseq" associated seqoutall qualifiers
-osformat2
-osformat_outseq
string Output seq format Any string  
-osextension2
-osextension_outseq
string File name extension Any string  
-osname2
-osname_outseq
string Base file name Any string  
-osdirectory2
-osdirectory_outseq
string Output directory Any string  
-osdbname2
-osdbname_outseq
string Database name to add Any string  
-ossingle2
-ossingle_outseq
boolean Separate file for each entry Boolean value Yes/No N
-oufo2
-oufo_outseq
string UFO features Any string  
-offormat2
-offormat_outseq
string Features format Any string  
-ofname2
-ofname_outseq
string Features file name Any string  
-ofdirectory2
-ofdirectory_outseq
string Output directory Any string  
General qualifiers
-auto boolean Turn off prompts Boolean value Yes/No N
-stdout boolean Write first file to standard output Boolean value Yes/No N
-filter boolean Read first file from standard input, write first file to standard output Boolean value Yes/No N
-options boolean Prompt for standard and additional values Boolean value Yes/No N
-debug boolean Write debug output to program.dbg Boolean value Yes/No N
-verbose boolean Report some/full command line options Boolean value Yes/No Y
-help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose Boolean value Yes/No N
-warning boolean Report warnings Boolean value Yes/No Y
-error boolean Report errors Boolean value Yes/No Y
-fatal boolean Report fatal errors Boolean value Yes/No Y
-die boolean Report dying program messages Boolean value Yes/No Y
-version boolean Report version number and exit Boolean value Yes/No N

Input file format

splitsource reads any normal sequence USAs.

Input files for usage example

Database entry: qasrswww:A01139

ID   A01139; SV 1; linear; unassigned DNA; PAT; PRO; 279 BP.
XX
AC   A01139;
XX
DT   16-MAR-1994 (Rel. 38, Created)
DT   14-FEB-2001 (Rel. 66, Last updated, Version 5)
XX
DE   Fusion DNA (L.lactis MSP signal sequence and H.medicinalis desulfatohirudin
DE   coding sequence)
XX
KW   .
XX
OS   Lactococcus lactis
OC   Bacteria; Firmicutes; Lactobacillales; Streptococcaceae; Lactococcus.
XX
OS   Hirudo medicinalis (medicinal leech)
OC   Eukaryota; Metazoa; Annelida; Clitellata; Hirudinida; Hirudinea;
OC   Arhynchobdellida; Hirudiniformes; Hirudinidae; Hirudo.
XX
RN   [1]
RP   1-279
RA   Suri B., Schmitz A.;
RT   "Bacterial vectors.";
RL   Patent number EP0449770-A2/2, 02-OCT-1991.
RL   CIBA-GEIGY AG.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..81
FT                   /organism="Lactococcus lactis"
FT                   /focus
FT                   /strain="LM0230"
FT                   /mol_type="unassigned DNA"
FT                   /db_xref="taxon:1358"
FT   source          82..279
FT                   /organism="Hirudo medicinalis"
FT                   /mol_type="unassigned DNA"
FT                   /db_xref="taxon:6421"
FT   CDS             1..279
FT                   /transl_table=11
FT                   /note="fusion of MSP signal peptide and hirudin"
FT                   /protein_id="CAA00134.1"
FT                   /translation="MKKKIISAILMSTVILSAAAPLSGVYAVVYTDCTESGQNLCLCEG
FT                   SNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ"
FT   mat_peptide     82..279
FT                   /product="desulfatohirudin"
FT   sig_peptide     1..81
FT                   /product="MSP signal peptide"
XX
SQ   Sequence 279 BP; 76 A; 66 C; 68 G; 69 T; 0 other;
     atgaaaaaaa agattatctc agctatttta atgtctacag tgatactttc tgctgcagcc        60
     ccgttgtcag gtgtttacgc tgttgtttac accgactgca ccgaatctgg tcagaacctg       120
     tgcctgtgcg aaggttctaa cgtttgcggt cagggtaaca aatgcatcct gggttctgac       180
     ggtgaaaaaa accagtgcgt taccggcgaa ggtaccccga aaccgcagtc tcacaacgac       240
     ggtgacttcg aagaaatccc ggaagaatac ctgcagtag                              279
//

Output file format

splitsource outputs a graph to the specified graphics device. outputs a report format file. The default format is ...

Output files for usage example

File: a01139.fasta

>A01139_1_1-81 organism="Lactococcus lactis" strain="LM0230" Fusion DNA (L.lactis MSP signal sequence and H.medicinalis desulfatohirudin coding sequence)
atgaaaaaaaagattatctcagctattttaatgtctacagtgatactttctgctgcagcc
ccgttgtcaggtgtttacgct
>A01139_2_82-279 organism="Hirudo medicinalis" Fusion DNA (L.lactis MSP signal sequence and H.medicinalis desulfatohirudin coding sequence)
gttgtttacaccgactgcaccgaatctggtcagaacctgtgcctgtgcgaaggttctaac
gtttgcggtcagggtaacaaatgcatcctgggttctgacggtgaaaaaaaccagtgcgtt
accggcgaaggtaccccgaaaccgcagtctcacaacgacggtgacttcgaagaaatcccg
gaagaatacctgcagtag

Data files

**************** EDIT HERE ****************

Notes

None.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program name Description
aligncopy Reads and writes alignments
aligncopypair Reads and writes pairs from alignments
biosed Replace or delete sequence sections
codcopy Copy and reformat a codon usage table
cutseq Removes a section from a sequence
degapseq Removes non-alphabetic (e.g. gap) characters from sequences
descseq Alter the name or description of a sequence
entret Retrieves sequence entries from flatfile databases and files
extractalign Extract regions from a sequence alignment
extractfeat Extract features from sequence(s)
extractseq Extract regions from a sequence
featcopy Reads and writes a feature table
featreport Reads and writes a feature table
listor Write a list file of the logical OR of two sets of sequences
makenucseq Create random nucleotide sequences
makeprotseq Create random protein sequences
maskambignuc Masks all ambiguity characters in nucleotide sequences with N
maskambigprot Masks all ambiguity characters in protein sequences with X
maskfeat Write a sequence with masked features
maskseq Write a sequence with masked regions
newseq Create a sequence file from a typed-in sequence
nohtml Remove mark-up (e.g. HTML tags) from an ASCII text file
noreturn Remove carriage return from ASCII files
nospace Remove whitespace from an ASCII text file
notab Replace tabs with spaces in an ASCII text file
notseq Write to file a subset of an input stream of sequences
nthseq Write to file a single sequence from an input stream of sequences
nthseqset Reads and writes (returns) one set of sequences from many
pasteseq Insert one sequence into another
revseq Reverse and complement a nucleotide sequence
seqret Reads and writes (returns) sequences
seqretsetall Reads and writes (returns) many sets of sequences
seqretsplit Reads sequences and writes them to individual files
sizeseq Sort sequences by size
skipredundant Remove redundant sequences from an input set
skipseq Reads and writes (returns) sequences, skipping first few
splitter Split sequence(s) into smaller sequences
trimest Remove poly-A tails from nucleotide sequences
trimseq Remove unwanted characters from start and end of sequence(s)
trimspace Remove extra whitespace from an ASCII text file
union Concatenate multiple sequences into a single sequence
vectorstrip Removes vectors from the ends of nucleotide sequence(s)
yank Add a sequence reference (a full USA) to a list file

Author(s)

**************** EDIT HERE ****************

History

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

None